SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000017794 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000017794
Domain Number 1 Region: 38-107
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000206
Family Cold shock DNA-binding domain-like 0.00065
Further Details:      
 
Domain Number 2 Region: 129-174
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000384
Family Retrovirus zinc finger-like domains 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000017794
Sequence length 205
Comment (Monodelphis domestica)
Sequence
MGSVSNQQFAGGCAKAAEEAATGDAARAGEEPQPLHGAGICKWFNVRMGFGFLSMTARAG
VALDQPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCLGSERR
PKGKTLQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQSPS
SQGKPAYFREEEEIHSPALLPEAQD
Download sequence
Identical sequences F6T943
ENSMODP00000017794 XP_001363469.1.35504 13616.ENSMODP00000017794 ENSMODP00000017794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]