SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000020399 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000020399
Domain Number 1 Region: 241-328
Classification Level Classification E-value
Superfamily RING/U-box 1.15e-20
Family RING finger domain, C3HC4 0.053
Further Details:      
 
Domain Number 2 Region: 153-179
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000458
Family Retrovirus zinc finger-like domains 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000020399
Sequence length 1727
Comment (Monodelphis domestica)
Sequence
MSCVHYKFSSKLNYDTVTFDGLHISLCDLKKQIMGREKLKAADCDLQITNAQTKEEYTDD
NALIPKNSSVIVRRIPIGGVKSTSKTYVISRTEPVSGTSKAIDDSSASISLAQLTKTANL
AEANASEEDKIKAMMSQSGHEYDPINYMKKPLGPPPPSYTCFRCGKPGHYIKNCPTNGDK
NFESVPRIKKSTGIPRSFMMEVKDPNMKGAMLTNTGKYAIPTIDAEAYAIGKKEKPPFLP
EEPSSSSEEDDPIPDELLCLICKDIMTDAVVIPCCGNSYCDECIRTALLESDEHTCPTCH
QNDVSPDALIANKFLRQAVNNFKNETGYTKRLRKQIPPPPPPIPPPRPLIQRNLQPLMRP
PISRQQDPLMIPVTSASTHAATSISSSMTPNQSSLSSAVPINQPTTPAPVPDITATVSIS
VHSEKPDGPFRDPDNKIIPAAALVSDHPKASSSIAISALMEEKGYQVPVLGTPSLLGQSL
LHGQLIPTTGPVRINAARSAGGRPGWEPPYHSSALEPIHSIISKMEGSINRGRHHGERSQ
RTQGPSLPATPVFVPVPPPPLYPPPPHTLPLPPGVPPPQFPPQFPPGQPPPAGYSVPPPG
FPPAPTNLSTPWVSTAVQTAHSNTIPTTQAPPLSREEFYREQRRLKEEEKKKSKLDEFTN
DFAKELMEYKKIQKERRRSFSRSKSPYSGSSYSRSSYTYSKSRSGSSRSRSYSRSFSRSH
SRSYSRSPPYPRRGRGKSRNYRSRSRSHGYHRSRSRSPPYRRYHSRSRSPPVFRGQSPNK
RNVPQGETEREYFNRYREVPPPYDIKAYYGRNVDFRDPFEKERYREWERNYREWYEKYYK
GYAAGAQPRPPANRENFSPERFGPLGNRRENSPFARGRREDYSGVQGHRSRNIGSNYPEK
LSARDGHTMKDSAKSKEKESENPPGDGKGNKHKKHRKRRKGEENEGFPNTELLESSRKQR
EPVGGEDIKTDSLFILPSRDDATPVRDEPMEAESITFKPLSEKEKKEKDKPKAKGDKTKR
KNEGTTGSKKESTAKPVKASQEKTDIEREKSPRSEPPSKKAKEEVPKTESTKSSSQKDEK
TISTPRKTHPKVTKEHQETKSIKEEKVKKEYSKDAKQEKLANKEEKSKKTNEKSKPADAK
PEKRKRKAEEKGVDKEHEILSLKSSKPEVAEMMKPSPKRKIEPDAEKTDRTPEKDKAVLT
APAKKIKLNRETGKKIGSGENLPNAKELTEKLEPTSSKIKQEKVKGKVRRKVTATEGSSS
TLVDYTSTSSTGGSPVRKCEEKTDTKRTVIKTMEEYNNDNTAPAEDVIIMIQVPQSKWDK
DDFESEEEDIKSTQALSSVGKPASVIKNVSTKPSNPVKLIEKESEPSEKIQKPTKEVSHE
GVQHEAKSSKTCSSSDKGKTKDRDHSVSDKENSEKRKSSIQTEKDTTVDRISEQGNFKSL
SQSSKDSRTSDKHDSGRGSSSKDFTPNRDKKIDYDNRDHSGSKRRDERSDLTRRKDSPSR
TKLESSLGQKNKLKDERTDLPKKGVGESKRGNSSPSKDRRPYDHKAAHDSKRSNDDNKSV
DKNPVKEREKHISETKNNKEKELSGNKLFCKHSSPDTQIEKEHVTTGQNDKTVVKPKPQL
SHSSRLSSDLTRETDEAAFVPDYNESDSESNVSAKEEETLGKNPKELKEKVAEKAKETLE
TTVVGQIGIRSQSQSSPSVSRSRSHSPSGSQTRSHSSSASSAESQDS
Download sequence
Identical sequences 13616.ENSMODP00000020399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]