SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000021311 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000021311
Domain Number 1 Region: 17-88
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000000119
Family Cold shock DNA-binding domain-like 0.0029
Further Details:      
 
Weak hits

Sequence:  13616.ENSMODP00000021311
Domain Number - Region: 130-147
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000398
Family Retrovirus zinc finger-like domains 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000021311
Sequence length 232
Comment (Monodelphis domestica)
Sequence
MNPGRCESLDDLPDLYTIFRGEVVTVTEYGAFIKIPGCRKQGLVHRTHMSSCRVDKPSEI
VDVGDKVWVKLIGREMKNDKVKLSLSMKVVNQGTGKDLDPNNIVTDQEERRKRTFKDYTG
QKITLEAVLNTTCKKCGCRGHFAKDCFMQPGGTKYMILKDRTNPCREFYSLFSCPSSHQE
KKKKKKLKSKKEPSSSSSDSDSSEGQTASKKARHLARESKRKMKKHRKKHQA
Download sequence
Identical sequences 13616.ENSMODP00000021311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]