SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000021871 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000021871
Domain Number 1 Region: 185-315
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.7e-25
Family Voltage-gated potassium channels 0.0026
Further Details:      
 
Weak hits

Sequence:  13616.ENSMODP00000021871
Domain Number - Region: 330-449
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.00181
Family Potassium channel NAD-binding domain 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000021871
Sequence length 1169
Comment (Monodelphis domestica)
Sequence
RVQVEFYVNENTFKERLKLFFIKNQRSSLRIRLFNFSLKLVTCLLYIVRVLLDDPVQGIG
CWGCPKQNYTVFNQSSPEIDWAPILWVERKMTLWALQVIIALISFLETMLLIYLSYKGNI
CEQIFRVSFILEMINTVPFIITIFWPPLRNLFIPVFLNCWLAKYALEKHDCKNDFHRAIL
RTQSAMFNQVLILFCTLLCLLFTGTCGIQHLERAGDNLSLLKSFYFCIVTFSTVGYGDVT
PKIWPSQLLVVIMICVALVVLPLQFEELVYLWMERQKSGGNYSRHRAQTEKHVVLCVSSL
KIDLLMDFLNEFYAHPRLQDYYVVILCPTEMDIQVRRVLQIPLWSQRVIYLQGSALKDQD
LLRAKMDNGEACFILSSRNEVDRTAADHQTILRAWAVKDFAPNCPLYVQILKPENKFHVK
FADHVVCEEECKYAMLALNCICPATSTLITLLVHTSRGQEGQDSPEQWQRMYGRCSGNEV
YHIRMGDSKFFMEYEGKSFTYAAFHAHKKYGVCLIGLKREENKSILLNPGPRHIMAASDT
CFYINITKEENSAFIFKQEEKQKRQGFPGRGLYDGPSRLPVHSIIASMGTVAMDLQSTDC
RPTNSSKLTLPTENGSSSRRPSIAPVLELADSSSLLPCDLLSDQSEDEMTPSDDEGLTMV
EYVKGYPPNSPYIGSSPTLCHLLPVKAPFCCLRLDKGCKHNSYEDAKAYGFKNKLIIVSA
ETAGNGLYNFIVPLRAYYRSRKELNPIVLLLDNKPDHHFLEAICCFPMVYYMEGSVDNLD
SLLQCGIIYADNLVVVDKESTMSAEEDYMADAKTIVNVQTMFRLFPSLSIITELTHPSNM
RFMQFRAKDSYSLALSKLEKRERENGSNLAFMFRLPFAAGRVFSISMLDTLLYQSFVKDY
MISITRLLLGLDTTPGSGYLCAMKITDDDLWIRTYGRLFQKLCSSSAEIPIGIYRTESHM
FSTSEPHDLRAQSQISVNVEDCEDTKDVKESWGSRSGSGTSHHRPHRNSCTSDQSDHPLL
RRKSMQWARRLSRKGHKNTSKTAEWINQQRLSLYRRSERQELSELVKNRMKHLGLPTTGY
EDVANLTASDVMNRVNLGYLQDEMNDHQNTLSYVLINPPPDTRLELNDIVYLIRSDPLAH
VTNDTHSRKSSCSNKLDPCHPETRDETQL
Download sequence
Identical sequences F7EHV8
ENSMODP00000021871 ENSMODP00000021871 13616.ENSMODP00000021871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]