SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000025345 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000025345
Domain Number 1 Region: 170-221
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000000209
Family Retrovirus zinc finger-like domains 0.0022
Further Details:      
 
Domain Number 2 Region: 116-164
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000349
Family Retrovirus zinc finger-like domains 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000025345
Sequence length 262
Comment (Monodelphis domestica)
Sequence
MTRWARTNTAHNKKALKATSWEDMKKGSTEQATPNLQKHTQFHSSGLSLKNDVPRSKNKK
KTSYTNQDVNGFMEYLRQNGEMTAVGSSEIREEIAIALKKDSRREGRRLKRQKIKKNAKV
CYHCRKQGHGVADCPAVLESQDMGTGICYRCGSTEHEITKCKAKVDPAMGEFPFAKCFIC
GEMGHLSRSCPDNPKGLYAEGGGCRLCGSVEHFKKDCPENQNSDHMVTVGRWAEGMSADY
EEILEAPKPQKPKTAIAKVVNF
Download sequence
Identical sequences F7CJH8
13616.ENSMODP00000025345 ENSMODP00000025345 XP_007487435.1.35504 XP_007487436.1.35504 XP_007487437.1.35504 XP_007487438.1.35504 ENSMODP00000025345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]