SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000029643 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000029643
Domain Number 1 Region: 29-100
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000000142
Family Cold shock DNA-binding domain-like 0.00063
Further Details:      
 
Domain Number 2 Region: 141-186
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000192
Family Retrovirus zinc finger-like domains 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000029643
Sequence length 268
Comment (Monodelphis domestica)
Sequence
SIKGGASKGGGDEPGKLQEQEEEESQVLHGTGHCKWFNVRMGFGFISMINREGSPLDIPV
DVFVHQSKLYMEGFRSLKEGEPVEFTFKKSSKGLESIRVTGPGGNPCLGSERRPKGKTLQ
KRKPKGDSWGFRTVCEIWTRESRREGCYNCGGLDHHAKECSLPPQPKKCHYCQSIMHMVA
NCPHKTVPQPPTSSQGRHEAEPQPSTSTFPREVAGAYGYSSPSYSQEGRSEISERSGRSP
QETSSSKLSTSPEEQSRKGPSVQKRKKT
Download sequence
Identical sequences 13616.ENSMODP00000029643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]