SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000032954 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000032954
Domain Number 1 Region: 545-848
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.84e-48
Family Tandem AAA-ATPase domain 0.00025
Further Details:      
 
Domain Number 2 Region: 406-441
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000344
Family Retrovirus zinc finger-like domains 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000032954
Sequence length 1226
Comment (Monodelphis domestica)
Sequence
MERYQEVRTLLKTWEKAFFQEHKRKPNKSDVESAPEETKELYREYRTLRKSQESVGLSQP
SNSGQQDPAVEQQTPELDFWGAHLNRNMTKPPLPTQTAILQVPSQCYGKKLKSNLKAALQ
VGPSSGRIPRLPCRQQPKTCPSPKSHLSVPFAPPEVIPSSCEGDVVMLKPSIPTWSCGPK
FIPQLGKLKQLQHTLGQRLSSLDPGWLQRCQDEAKEKPERLEHSSSLSSLSETLTTKPVF
GSLPEKEDAPSMSEVRTLQRNLTQKRQRDESQDRTLKHQKIGTKKKKLRSESAPESNGEH
TRESGRVAALEIPKEDLLGEMVVERMAKTVTGAKAPRYCSQVKLGRQTSNHSDHFTELWV
FFRTFSKANGNFVRLNLKKKCYAKGFVLRGKHLRKQIWKKKWQMKGEQFGGGWSRGRGKE
SCFRCGGAGHWASQCPGRESKKWSRQSQPEEPVPPKGPECKAPELPSAVEPLYGLGPSGQ
VAETPLEVFETLTRFGYHTFRPGQEAAIMRILSGLSTLVVLPTGMGKSLCYQLPALLYAQ
RSCCITLVVSPLLSLMDDQVSGLPPGLKAVCVHSNMTRKQRETAMEKVMTGKVQVLLLSP
EAVVGAGGFSCLPPAARLPPVAFACIDEAHCLSQWSHNFRPCYLRLCKVLRERLGVRCFL
GLTATATCATARDVGEHLGIPEEAIFGTHLAAIPPNLHLSVSLDRDKDQALVSLLQGERF
RDLSSIIVYCNRRDETVRVAALIRTCLQDFPVPFAGRLPEAVAEAYHAGLSASERRRVQR
AFMQGRLRVVVATVAFGMGLDRPDVRAVLHHGLPGSIESYVQEIGRAGRDGLPAHCHLFL
QPQGEDLRELRRHIYADTVDYLTLKKLVQRLFPPCTCSKQLQQPQMQEVPSSGGEGVQEA
GPQEESEVPANVLRICPGHERAFSVQQMVETLDMREEAIETLLCYLELHPRSWLKLLAPI
FAICHLKCYGGPPQLQALAKRCPAVAVGLAQQQSAKDKGRSSLDFNVVELADSMGWEAAL
VRRTLNQLQWEVTPGKGAPRRTGVLVEFRDLSFHMRSPGLTAFEQDEICDFLHQRIQARE
KEALAQLRATFQAFQRVAFPNCGPCMEHVDEERSDQLKALLTRYFEEGTAALFEDQFREE
SEQNHDFGQARLQDWESSICSDIRHLLSIRQEEKFSGRALARIFHGIGSPCYPAEVYGKD
RRFWRKYLHVSFPSLLRLATREILAW
Download sequence
Identical sequences 13616.ENSMODP00000032954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]