SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000034120 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000034120
Domain Number 1 Region: 146-221
Classification Level Classification E-value
Superfamily RING/U-box 5.3e-17
Family RING finger domain, C3HC4 0.022
Further Details:      
 
Domain Number 2 Region: 51-85
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000314
Family Retrovirus zinc finger-like domains 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000034120
Sequence length 222
Comment (Monodelphis domestica)
Sequence
KKETQRKTDSSASASVAQLIKFANLTEADASEEDKVQAMMIQSVHEYDPIHYTKTPPGPP
PPSYTCFRCGKPGHYIKNCPTKGDKDFDPVPRMKKSTGIPRSFMMEVKDPNMKGAMLTDT
GKYVIPTIDAEAYARGKKEKPPFLPAEESSSSEVEDPIPDELLCLICKAIMTDAAVIPCC
GNSYCDECIRTALLESDGHTCPTCHQNDVSPDALIANKCLRR
Download sequence
Identical sequences F7E4B3
ENSMODP00000034120 ENSMODP00000034120 13616.ENSMODP00000034120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]