SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000034335 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000034335
Domain Number 1 Region: 65-115
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000121
Family Retrovirus zinc finger-like domains 0.0014
Further Details:      
 
Weak hits

Sequence:  13616.ENSMODP00000034335
Domain Number - Region: 7-62
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000567
Family Retrovirus zinc finger-like domains 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000034335
Sequence length 119
Comment (Monodelphis domestica)
Sequence
MSSNKYFKCGCSVHWAQECPTGGDRGRRMWSHGRGFQFVSSSLPDIYYRCGESDHLAKDC
DLQADACYNCSRGVHVAKDCKEPNPSTWLDCDHADEQKCYSCGEFGHIQKDCTKVKCYR
Download sequence
Identical sequences F7EJV2
ENSMODP00000034335 ENSMODP00000034335 13616.ENSMODP00000034335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]