SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000037503 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000037503
Domain Number 1 Region: 30-205
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-37
Family SPRY domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000037503
Sequence length 211
Comment (Monodelphis domestica)
Sequence
ALSAVLEVWSVYSWGSRWGLGPFHCFSLVCSTAISFKLEEKTAHSSLALFKEETGVKYGL
VGLEPTKVALNVERFRDWAVVLGDTRVTTGQHYWEVTVKKSKHFRIGVADVDIPRDGCIG
VDSHSWVFAYAHQKWHAMLAKESFPITGIGHPEKVGLLLNYEAQRLSLVDISRTAVVYTL
RTEFHGPVVPAFALWDGQLLTHSGLDVPEGM
Download sequence
Identical sequences 13616.ENSMODP00000037503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]