SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000037974 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000037974
Domain Number 1 Region: 38-621
Classification Level Classification E-value
Superfamily Prokaryotic type I DNA topoisomerase 1.1e-161
Family Prokaryotic type I DNA topoisomerase 0.0000133
Further Details:      
 
Weak hits

Sequence:  13616.ENSMODP00000037974
Domain Number - Region: 959-991
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00366
Family Retrovirus zinc finger-like domains 0.0085
Further Details:      
 
Domain Number - Region: 660-691
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0629
Family PhnA zinc-binding domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000037974
Sequence length 993
Comment (Monodelphis domestica)
Sequence
MIFPIVGLCLRAARVLPGLWGRPLSQDAMEVAFRGSRRVLCVAEKNDAAKGIADLLSGSR
MRRKEGLSVVRIKFFVESHTKKGRNVTMVMTSVSGHLLAHDFQMPFRKWSSCNPLVLFEA
QIEKYCPENFVDIKRTLEKEVQQCQSLVIWTDCDREGENIGFEIIHVCKAVKPNLRVFRA
RFSEITEHAVKTACQHLTEPDQRVSDAVDVRQELDLRIGAAFTRFQTLRLQKIFPEVLAE
QLISYGSCQFPTLGFVVERFKAIQAFVPETFHKIKVTHEHEDGLVDFSWKRHRLFNHTAC
LVLYQMCMEDPVATVVEVGSKPKSRWRPQPLDTVELEKLASRKLKINAKETMKIAEKLYT
QGYISYPRTETNIFPKDLNLTALVQQQIHDQQWGAFAQRILDRGGPTPRNGKKSDQAHPP
IHPTKYTCNLQGNEQRLYEFIVRHFLACCSEDAQGQETTVEIDIAQERFVAHGLMILAKN
YLEVYLYDRWSDKIIPVYEKGSRFQPTTVEMVDGETSPPQLLTEADLIALMEKHGIGTDA
THAEHIETIKSRMYVGLTPDKRFLPGHLGMGLVEGYDSMGYEMSKPDLRAELEADLKLIC
EGKKDKHVVLRQQIQKYKQVFIEAVAHANKLDEALSQYFGEMATAVRQEEIYPAMPETIR
KCPQCHRDMEKAVVGDGAFYLSCVGYPDCRKAVWFPDFVLEASKDGSVCPVCKPHPVYRL
KLKFKRGSIPPAMPLELVGCVGGCDESLVQILDLRHSSGPSRAPQPGGRPTHHLQTNQSL
NRMGHAQGGHSVTPPNLSAGTRAPQAAASENHNTVVCNCGQEALLLTVRKEGPNQGRLFY
KCHAGSCNFFLWADVQQRSETAPPRAAAPGPLQRPDGFGDQGGGGGATCLCSQPAVTRTV
QKEGPNKGRQFHTCSKPREQQCGFFQWADENVAPGEAPSGAAGSGPRGPAREAEARSKRP
RNPSNPEPGPKKVRKCSLCHQPGHNRTSCPQGR
Download sequence
Identical sequences 13616.ENSMODP00000037974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]