SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000038300 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  13616.ENSMODP00000038300
Domain Number - Region: 88-116
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00335
Family Retrovirus zinc finger-like domains 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000038300
Sequence length 210
Comment (Monodelphis domestica)
Sequence
GGPKRAREAAELEQQRRQEQKRRRRDAQQRQQLQHLESFYEKPPPGLIKEDETKPEDCIP
DVPGNEHAREFLAHAPTKGLWMPLGKEVKVMQCWRCKRYGHRTGDKECPFFIKGNQKLEQ
FRVAHEDPMYDIIRENKRHEKDVRIQQLKKLLEDSTSDEDGTSSSSSECKEKHKRKKKKE
KHKKRKKEKKKRKKKKKKHKSKSNESSDSD
Download sequence
Identical sequences F6VJC0
13616.ENSMODP00000038300 ENSMODP00000038300 ENSMODP00000038300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]