SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000038561 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  13616.ENSMODP00000038561
Domain Number - Region: 35-71
Classification Level Classification E-value
Superfamily FnI-like domain 0.0408
Family Fibronectin type I module 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000038561
Sequence length 113
Comment (Monodelphis domestica)
Sequence
NTILGILLTWTIFGTLYETQCTDIPLEFNMEVQTNGCKDHHGEIHELNIYWFTDDCEMCH
CSPEGMECSSAISMPIGYDKEKCKVVFNAEECIYKAVEKDNPSQSCKVSKYVV
Download sequence
Identical sequences F6T2S6
ENSMODP00000038561 ENSMODP00000038561 13616.ENSMODP00000038561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]