SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 138119.DSY1349 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  138119.DSY1349
Domain Number 1 Region: 105-382
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 6.55e-69
Family D-glucarate dehydratase-like 0.000000422
Further Details:      
 
Domain Number 2 Region: 1-122
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 9.93e-29
Family Enolase N-terminal domain-like 0.0000341
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 138119.DSY1349
Sequence length 389
Comment (Desulfitobacterium hafniense Y51)
Sequence
MKITKVDILQLDTVENKHWRPILCRIFTDEGIYGDGEAALAYATAAPAAFGMVKDFASLI
IGLDPLEHEVIWDKLYKGTFWGQNGGPVVFAGISAIDIALWDIKGKAYGKPVYQLLGGKK
REKLRTYASQLQFGWSETRGPLYKAEDYGLVAREVVAEGYNAVKVDFFTYDEKGARLTSE
KQTRLLSSHYLNLVEERVAATREAVGPDVDIIVENHANTDALSAIQIGRRIEKYNIFYYE
EPATPNPKTFAYISSKLDLPLASGERIYSRWQYAPYFENSSLQVIQPDLGNTGGITEGKK
ICDAAYVYDVSVQLHVCGSPIAIAAALHLETVIPNFLIHEHHFPNGLNRKLCIHDYQPED
SYLTVPELPGLGNEISEYVYANSIRVTVE
Download sequence
Identical sequences A0A098AZ06 Q24XV4
WP_011459641.1.80252 138119.DSY1349 gi|89894095|ref|YP_517582.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]