SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 138119.DSY1748 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  138119.DSY1748
Domain Number - Region: 96-156
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00471
Family NfeD domain-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 138119.DSY1748
Sequence length 158
Comment (Desulfitobacterium hafniense Y51)
Sequence
MVTGGVVALVILGLSFLFLEIFIPGGILGIAGLVLLSAGIFLTAESALHGVAYVCTMLLI
LGILVALSFRFPRTRRFWQRFSLNAKQSNREGYVAPTVDLESYVGCEGVAISPLRPAGTA
DFDGKRLDVVTEGGFIDIHSPVKVIAVEGTRVVVRQMS
Download sequence
Identical sequences A0A098B0C1 G9XN85 Q24WQ5
138119.DSY1748 WP_005812221.1.73069 WP_005812221.1.80252 WP_005812221.1.88067 WP_005812221.1.94859 gi|89894494|ref|YP_517981.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]