SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 138119.DSY3263 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  138119.DSY3263
Domain Number 1 Region: 1-99
Classification Level Classification E-value
Superfamily SpoIIaa-like 9.61e-24
Family Anti-sigma factor antagonist SpoIIaa 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 138119.DSY3263
Sequence length 100
Comment (Desulfitobacterium hafniense Y51)
Sequence
MSIDIRVDRQEVFVELEGKIYVEDAAVMRERLLPLIEQGKSHFVFDTHKLNYIDSSGLGV
LVAIHKRAIERGGGIVVQGLQGAVKELFQLTRLNKVFEIR
Download sequence
Identical sequences Q24SE0
gi|89896009|ref|YP_519496.1| WP_011460961.1.80252 138119.DSY3263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]