SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 138119.DSY4838 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  138119.DSY4838
Domain Number 1 Region: 139-422
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 3.25e-132
Family Enolase 0.0000000183
Further Details:      
 
Domain Number 2 Region: 3-138
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 7.07e-58
Family Enolase N-terminal domain-like 0.00000364
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 138119.DSY4838
Sequence length 425
Comment (Desulfitobacterium hafniense Y51)
Sequence
MSYIEEIYGREILDSRGNPTVEVEVLLEDGSMGRAAVPSGASTGAFEAVELRDGDKGRFL
GKGVLQAVANVNEVIAPELEGLNPFDQPAIDRELIALDGTENKGKLGANAILGVSLANAK
AAAECVGLPLYQYLGGVNAKELPVPMMNILNGGQHADNNVDIQEFMIMPVGAKSFAEALQ
MGTEVYHSLKAVLKEKSLATAIGDEGGFAPSLESNADALLAIMDAIQRAGYTPGKDIALA
LDVAATELYRDGKYHLEGEGLTKTADEMIAYYEDLVEKYPIVSIEDGLSEEDWEGWKKLT
EKLGSKIQLVGDDLFVTNPARLARGIKEKCANSILIKLNQIGTLTETLDAIEMAKRAGYT
TVISHRSGETEDVTMAHVAVAVNAGQIKTGAPARTERVAKYNELLRIEEELGETGVYPGH
EALGR
Download sequence
Identical sequences A0A0W1JPJ5 G9XTL5 Q24MW5
gi|89897584|ref|YP_521071.1| 138119.DSY4838 WP_005815650.1.73069 WP_005815650.1.80252 WP_005815650.1.94859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]