SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 138119.DSY4904 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  138119.DSY4904
Domain Number 1 Region: 9-185
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 6.59e-74
Family Ferredoxin domains from multidomain proteins 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 138119.DSY4904
Sequence length 204
Comment (Desulfitobacterium hafniense Y51)
Sequence
MAIVTEQSIRYGMVIDLRKCVGCNACTVSCKIENNVPDGKYRTWVKEMEKGTYPQVSRHR
LPRLCNHCDNAPCESACPVRATYRTEDGTILIDYDRCIGCKYCMAACPYDARFVNPVRRT
AEKCTFCYHRVQMGLLPACVTTCVGGARIFGDLHDPNSLVSRLIANNPVQVLKPEMNTQP
MIYYIGADQAVLGADYTDLEKGGK
Download sequence
Identical sequences Q24MP9
gi|89897650|ref|YP_521137.1| 138119.DSY4904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]