SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 138119.DSY5042 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  138119.DSY5042
Domain Number 1 Region: 4-116
Classification Level Classification E-value
Superfamily TPR-like 1.52e-25
Family Tetratricopeptide repeat (TPR) 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 138119.DSY5042
Sequence length 133
Comment (Desulfitobacterium hafniense Y51)
Sequence
MSSNHYQQGLDHLEAGQLREAEEDFLQHLAQCPEDAMGYNKLGLVYGKSHDFERAKGCFL
KAIALDEGCIHAWNNLGNIARQDGDLDQAIRYYQKAVDIDPINPIPAKNLKRVQRQAKWS
FSRIKDLFGKNRD
Download sequence
Identical sequences A0A098BA02 B8G0J9 G9XSW3 Q24MB1
138119.DSY5042 272564.Dhaf_4942 gi|219670936|ref|YP_002461371.1| gi|89897788|ref|YP_521275.1| WP_005815170.1.13927 WP_005815170.1.73069 WP_005815170.1.80252 WP_005815170.1.94859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]