SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 146891.A9601_02331 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  146891.A9601_02331
Domain Number 1 Region: 449-544
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000139
Family Anti-sigma factor antagonist SpoIIaa 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 146891.A9601_02331
Sequence length 550
Comment (Prochlorococcus marinus AS9601)
Sequence
MKIINGFHLKNLRGDILGGITAAVVALPLALAFGNAALGPGGAIYGLYGAVVVGFLAALF
GGTPAQVSGPTGPMSVTVAGVVAGLAAVGVPRDLSAGQILPLVMAAVVIGGLLQILFGIL
KLGKYITLVPYSVVSGFMSGIGVIIIALQIGPLLGISTRGGVVESLSTVFSNFQPNGAAI
GVAIMTLGIVFLTPRKISQWVPSPLLALLIVTPISILIFGEGAIDRIGEIPRGVPSLNFP
SFNQYFPIIFKAGLVLAVLGAIDSLLTSLVADNISQTKHNSDRELIGQGIGNAVAGLFSG
LPGAGATMRTVINVKSGGSTPISGMVHSVVLLIVLVGAGPLAEQIPTALLAGILIKVGLD
IIDWGFLRRAHKLSLKTSVVMYGVLLMTVFWDLIWAVLVGVFIANMLTIDSITETQLEGM
DEDNPLSKDDQAKNALPADEKALLDRCSGEVMLFRLKGPLSFGAAKGISERMMLVRNYKV
LILDITDVPRLGVTATLAIEDMMQEAKNNSRKAFVAGANEKVKDRLAKFGVEGIIETRKE
ALETALNEIA
Download sequence
Identical sequences A2BP10
gi|123967770|ref|YP_001008628.1| WP_011817706.1.77012 146891.A9601_02331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]