SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 148305.A4QPQ2 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  148305.A4QPQ2
Domain Number 1 Region: 316-351
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000733
Family Retrovirus zinc finger-like domains 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 148305.A4QPQ2
Sequence length 400
Comment (Magnaporthe grisea)
Sequence
MQEAETQRARAETDRVRDKAQADILAMAMEKASAITSRDAAFAELEKTRSELKEVRTVTL
PTVHITTPAPTTNTPVEPLIVTPMGTTPPPASEHPASARLSERLPDPDKFTGARSDLRRF
ATQIRGKMTSNKDRFPNPESRLIYIAGRLSGKAYNLILPKMVGGTPQFGDYTDLLQYLEE
AFGDPDHVQNAQNKLYALKQRNVDFAEYLSEFQRLSLEGEMPEDALPPLLFQGISEELQD
MLLHNPAPSRQYHEFTRHLQSLDNRYRQHQQYKNRQTRTPRAAAPPARAAPRTQPDIPRA
APKPNAELPLNDPMDLSSQRRHNRKENMLCYHCGSQEHFVAKCPEPDTRRTRLHQAGIER
SRSRSRSPRQIQTKLPKNSRRGSDASRSSSRSSKNGARLG
Download sequence
Identical sequences 148305.A4QPQ2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]