SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 148305.A4QQQ7 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  148305.A4QQQ7
Domain Number 1 Region: 457-488
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000122
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 
Weak hits

Sequence:  148305.A4QQQ7
Domain Number - Region: 146-182
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.0863
Family Phase 1 flagellin 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 148305.A4QQQ7
Sequence length 516
Comment (Magnaporthe grisea)
Sequence
MSPRKNYGPPIRQSQRVTNANSAKPDNLASGTATPNTEGSDQNGEITVAPVSPEPVEPAP
TSANTEPEEPVEPQSDTEQDQPVDSIEVDGSYEYESVSEHPGEARNPPHQPSAKTLDGRN
EIPKFPSRAPSPVVQMRSEMADESENTAGQATITQSQLQDLLATIAQLKDQLATRSNNAT
RQTRGITPLNSAFGGAEFKPHGIAARTAFKPYGSNQNAKNPAYDRTARKAGIDPGMFNGD
KDRFDKWITKIADKFVEDDETYKTERSRMAVINSLTEGLANDLIQGRYESTIMPFSSAAE
MVATLAAVYHDDNQASKAREELRHLKFSLSDKLTDIHQFIGKVNSLADKANIAKTERKLV
LYEHVPASLNPQLLSLSKDPNISYETFAGEVANSALAQQRAWEELRENRKKREERRERSA
SAERKQRRRENRRHSQEAKNQARTQTVDAPKSPSRENAKLVIEGKCFLCQEAGHLARNCP
QKAAHIAAVLALQHEGDREAGERSGHSSTSSDSENC
Download sequence
Identical sequences 148305.A4QQQ7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]