SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 148305.A4QUI3 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  148305.A4QUI3
Domain Number 1 Region: 304-374
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000636
Family RING finger domain, C3HC4 0.03
Further Details:      
 
Domain Number 2 Region: 181-212
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000067
Family Retrovirus zinc finger-like domains 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 148305.A4QUI3
Sequence length 671
Comment (Magnaporthe grisea)
Sequence
MSSSVFFKFKSQKEPTRVEFDGTGISVFELKRDIILKSGLGDGTDFDLAIYTEDGAEESQ
TNISSPIDKEYDDDTTIIPRSTIVVARRLPSMKPGAGRAARYVSGKAPVNAKNSSRKEQV
AKASTTKAPSAALAQMSNAVTEEERLAAMFQAQSEQWTAQQEELSHQTPIYNGKPGVGKR
PANVPDHEPPNGYICYRCGEKGHWIQLCPTNDNPEFDNRPRVKRTTGIPKSFLKTVDKAT
VLGQAGVDGEEGKVPSGVMVNADGDFVIAQPDKAAWEKFQARTKVSAAAQKVAVQDEKEL
QDRGLECPMDKRLFNEPMKTPCCEKTYCNDCITNALIESDFVCPGCQAEGVLIDNLKPDD
ETTAKIKQYHEEKEKEQQKEKEKEADAPKSPAAAKSPSANNQSAKTTENNGADSKEVGKA
SSKSPTTSVKSLAKDPTSPTEISTPNGTVSNPKKRPADQPAENPRVPRAPKAMQQQQQQA
SHQQQQQQMMQQMMNGMNGGMNPMGMPMMPFAPMPMNGMNAGFMGMPNMGNMNMGNMMNP
MMGGGMGGFNGNGNMDYPMGGMSGNMNGNMNGNMSGNMQGNMQGGGWGMNGNGMHGGMGM
NGGYNNMNGHMNGGGFNGGYNMNGGGSNMGDFKQFSNQAATEDDAYFRKPVNPHRHQNRQ
KRVRPSDYREL
Download sequence
Identical sequences L7I4Y5 L7JDE1
148305.A4QUI3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]