SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 148305.A4QV72 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  148305.A4QV72
Domain Number 1 Region: 147-195
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000000864
Family Retrovirus zinc finger-like domains 0.0014
Further Details:      
 
Domain Number 2 Region: 46-97
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000157
Family Retrovirus zinc finger-like domains 0.0034
Further Details:      
 
Domain Number 3 Region: 5-46
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000233
Family Retrovirus zinc finger-like domains 0.0024
Further Details:      
 
Weak hits

Sequence:  148305.A4QV72
Domain Number - Region: 114-144
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000453
Family Retrovirus zinc finger-like domains 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 148305.A4QV72
Sequence length 230
Comment (Magnaporthe grisea)
Sequence
MSSLSRRACYKCGNVGHYAEVCSSAERLCYNCKQPGHESNGCPLPRTTEAKQCYHCQGLG
HVQADCPTLRLSGAGSNGRCYSCGQPGHLARACPNPNGANMGRGAPVPRGGYGGGYGGRG
GFAGGARPATCYKCGGPNHFARDCQAQAMKCYACGKLGHISRDCTAPNGGPLNTVGKTCY
QCGEAGHISRQCPTKATANGDSNAAAPAHNDAPMPDATAVAQAPIAAPVV
Download sequence
Identical sequences G4MRA3 L7IZM8
XP_003710840.1.18062 148305.A4QV72 MGG_13778T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]