SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 148305.A4QV96 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  148305.A4QV96
Domain Number - Region: 572-600,648-682
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000188
Family Anti-sigma factor antagonist SpoIIaa 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 148305.A4QV96
Sequence length 844
Comment (Magnaporthe grisea)
Sequence
MSTTGAKVGQGLAAALGIKLRNNEPYQDEVTRGESILSVQTADTFVETRPTTKEFFQELV
PSGKDVATYTRSLFPFLDWIGKYNLQWLLGDLVAGITIGAVVVPQGMAYAVLANLEPQFG
LYSSFMGVLIYWFFATSKDITIGPVAVMSTLVGGIVIEMKEKFPEVPGHVVASALSIITG
AIVLFLGLTRTGFIVDLISLTSLSAFMTGSAISIVIGQIPTMMGISGVSTRDASYLVLIN
TLKNLKTTKLDAAMGLSALAMLYIIRSACSFGAKKWPEKQKLYFFLGTLRTVFVILLYTM
ISWLVNMNHRSDPKFKILKDIPGGFQNAAVPVVETRVIGAMASNLPAAVIVLLIEHIAIS
KSFGRVNNYSINPSQEMVAIGVTNLLAPFLGGYPSTGSFSRTAIKSKAGVRTPFAGVITA
VVVLLAIYVLPPVFFYIPSASLAAVIIHAVGDLITPPNTLYQFWCVSPLEVLIFFIGVII
TVFSTIENGIYATVAISAAILLGRILKARGRFLGPVRVHSVLDDRIIGDDHREYGTFGQT
GTGTGGASTRNIFLPIDHGDGSNPDVEVESPYPGVFIYRFTEGFSYPNASHTLEYLTRYV
FAHTRRTNLTQYARPGDRPWNDPGPSKRELKRAQRSGGNLHIAGENPDLPTLKAIILDFS
SVNHVDVSSVQQLIDVRNQLDRYAAPDPVDWHIACIGNRWTKRALVAGGFGYPTPRDEGS
HRWKSIFSVAEIGGSDSAAAVAEKEEEQERRHAAASDADDLEKGVNVAPVHKATDGTETP
RTEASSTETERAAAASGAGLKGLRPAARAVTVHGLNRPLFHVDLTSALQSAIANIEARRG
GDGL
Download sequence
Identical sequences G4MRC6
XP_003710863.1.18062 MGG_04640T0 148305.A4QV96

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]