SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 148305.A4QVL6 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  148305.A4QVL6
Domain Number 1 Region: 129-248
Classification Level Classification E-value
Superfamily Cap-Gly domain 1.83e-27
Family Cap-Gly domain 0.0008
Further Details:      
 
Weak hits

Sequence:  148305.A4QVL6
Domain Number - Region: 418-543
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.00837
Family HBL-like 0.06
Further Details:      
 
Domain Number - Region: 875-894
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.034
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 148305.A4QVL6
Sequence length 900
Comment (Magnaporthe grisea)
Sequence
MTAPAGAPGQPQSASANNYTTTTPTGTPTTAQFHNLSNSGGKSLPRPPRKSNLYGLATAS
SPNLSTSYSRLAAPQHGLSRKASQQALTPNSLAAIPDDSESYAIGTVLNDSEAMLPPPPP
LTPGRPSGDGHIAIGDIVDVPGNMHGTVRFVGNVDGRKGIFAGVELHPEFAARGKNNGDV
DGISYFTTTKPGAGIFLPLTKAVKRDLAPSSTGSYPITPMNPPSGLKVGNQNSTNYTPPT
PSIPKFNQSTGPGRAPSPLGKKSSRPSLARPESPIRRLQMTPNPRPAIATPGSKVPSRYG
SPTSKFSQSVRGTAPDPAKRALKSVGPRSASALGNRAPSAAGFTDDEAAPIGLNRSGTNG
SVGSVTSFQAKLQRPASRANGRASPHRRNGSDELERLRLELADRDRQLKEQVQLVVEMET
SLTELQTFISKQGSQQQPPTRRGSTDDDKDVTQLRALLREKNEKIAMLTAEFDAHRADFR
STIDTLEMASTETERVYEKKLEEVMQELQDYQERTTDVNAVARQLKQLEELVQELEEGLE
DARRGEAEARGEVEFLRGEVERTRSELRREREKAAAGSNGAGAGNGNATSVSKELEQKED
EIRGLKAIIHSLSRDSIPGMPGDDTSKTPTSAHSGARGHLSDDSAGDRLARERLEREVAE
LRALLDSKNSREEEIMRELDTLRKAGGAGSPVLSKNRVSVATIVPTGQGNDRSSVRDSRD
TVILAGDDQKQQDGHQTKANEPRSPPRVKTHVRVATLDTMPESDAYSTATDTSTLYCELC
ETAGHGILNCTNMFGGNGATAGGNDSVKTPSPTLTKNGGLSLTVPHDSVDAPAPLSPIKT
KTPTPPSVPAMDAAQAHPSLMESGPVAGKESGVIDAEKWCALCERDGHDSVDCPFEDVAF
Download sequence
Identical sequences MGG_04472T0 148305.A4QVL6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]