SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 148305.A4QVX5 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  148305.A4QVX5
Domain Number 1 Region: 291-339
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000000688
Family Retrovirus zinc finger-like domains 0.00088
Further Details:      
 
Domain Number 2 Region: 365-408
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000000523
Family Retrovirus zinc finger-like domains 0.0017
Further Details:      
 
Domain Number 3 Region: 100-141
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000014
Family Retrovirus zinc finger-like domains 0.0023
Further Details:      
 
Domain Number 4 Region: 407-431
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000502
Family Retrovirus zinc finger-like domains 0.0057
Further Details:      
 
Weak hits

Sequence:  148305.A4QVX5
Domain Number - Region: 271-287
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0022
Family Retrovirus zinc finger-like domains 0.0056
Further Details:      
 
Domain Number - Region: 343-363
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00251
Family Retrovirus zinc finger-like domains 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 148305.A4QVX5
Sequence length 487
Comment (Magnaporthe grisea)
Sequence
MASWGTDSWGGCQSTTAHGGANDWNSSGQQTTGAGDWNAGAQQDTGGGEWNSGGEQATGT
NQWNSGEDGNNNKNDFGGGQFSGDEADAGGRGTQEPGAFDGTCNLCGKDGHRKRDCPEKP
PQLCANCQEEGHSVNECENPRKIDRSDVQDLEPAAAMAKIKEAVADDDMFDAKEAIRAYV
KALPNTDFVALENALRKHDVGVFLIAMELEMDETMTNMDLQGNLGKKYSVTYRFSGRCPR
PRDRQAWPKDAGENLERLKEAGDMVKTLVPRCRNCDALGHDRRQCPEDPIEKQQQAITCF
NCGETGHRVRDCTTPRVDKFACKNCNKSGHTAKECPEPRPVPEDLECTKCGEIGKHWRKD
CPQGAQSRACHNCGAEDHMSRDCTEPRRMKCRNCDEFDHVAKDCPKPRDMSRVKCMNCSE
MGHFKSKCPKPVVEDDAGDAGNGGFDNGGLDNSAGFDNGGDGGSWNAPTAADNGWQTSGG
GAGGSAW
Download sequence
Identical sequences L7IHU3 L7JCG4
148305.A4QVX5 MGG_06160T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]