SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 148305.A4QWM8 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  148305.A4QWM8
Domain Number 1 Region: 33-76
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000000345
Family Retrovirus zinc finger-like domains 0.0012
Further Details:      
 
Domain Number 2 Region: 129-176
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000000564
Family Retrovirus zinc finger-like domains 0.0017
Further Details:      
 
Domain Number 3 Region: 77-109
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000576
Family Retrovirus zinc finger-like domains 0.0039
Further Details:      
 
Domain Number 4 Region: 4-33
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000349
Family Retrovirus zinc finger-like domains 0.0048
Further Details:      
 
Domain Number 5 Region: 176-198
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000185
Family Retrovirus zinc finger-like domains 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 148305.A4QWM8
Sequence length 199
Comment (Magnaporthe grisea)
Sequence
MDFGGAQSGGAGGRTCYTCGQPNHQARDCPNRGAAKCYNCGGEGHISRACPEEPKDQKIC
YRCSQPGHISRDCPSGGAGGGGGGGGGQSSGAECYKCGEVGHIARNCSKGGYGGGGGGGY
SGGGGGYGGGYGGGAGGKTCYSCGGVGHMSRDCVNGSKCYNCGETGHFSRDCSKRSTTGE
KMCYKCQQPGHVQAECPNN
Download sequence
Identical sequences G4N4A8
XP_003711783.1.18062 148305.A4QWM8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]