SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 148305.A4QX13 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  148305.A4QX13
Domain Number 1 Region: 399-434
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000977
Family Retrovirus zinc finger-like domains 0.0034
Further Details:      
 
Weak hits

Sequence:  148305.A4QX13
Domain Number - Region: 140-199
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0531
Family Retroviral integrase, catalytic domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 148305.A4QX13
Sequence length 450
Comment (Magnaporthe grisea)
Sequence
MADHLLAARDARPVGKQWAYRFLFAKILTRLNAWFQLVANMRAKYGIQDCDMYNFDETGF
MMGQICAGMVVTGSERRGRRKKVQPGNREWATAICCISGDGYDIPPYIIVKGFYHLSNWY
TEGGLPDTWRLKPTVNGWTDNETGLDWVQHFDNHTKSRTKGVYRMLVLDGHGSHRSPEFE
GYCKDHNIIPLYLPAHSSHLTQPLDVGVFNVLKRAYGQKINDFIRAHITNISKVDFFLAF
AAAYKKSMTTRKYGRGFSRGGNYPPIARKWSYLKLDVRLRTPSPKELDFSSTETWVSQTP
HNPTEAVNQSTLVKSRINCHQGSSPTPIFNAVKQLAKGLESIAHRTTLLEAENHSLRKAN
EALSKRRRAQKTRIREGGSFTIQEGQNLLQSNGADGLIYEKKDENGEGSSAQPATKRRCG
NCGKPGHNARTCQEDAEMSDVHISDCIEVN
Download sequence
Identical sequences 148305.A4QX13

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]