SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 148305.A4QZF4 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  148305.A4QZF4
Domain Number 1 Region: 453-488
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000174
Family Retrovirus zinc finger-like domains 0.0045
Further Details:      
 
Weak hits

Sequence:  148305.A4QZF4
Domain Number - Region: 146-182
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.0837
Family Phase 1 flagellin 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 148305.A4QZF4
Sequence length 516
Comment (Magnaporthe grisea)
Sequence
MSPRKNYGPPIRQSQRVTNANSAKPDNLASGTATPNTEDSDQNGEITVAPVSPEPVEPAP
TSANTEPEEPVEPQSDTEQDQPVDSIEVDGSYEYESVSEHPGEARNPPHQPSAKTLDGRN
EIPKFPSRAPSPVVQMRSEMADESENTAGQATITQSQLQDLLATIAQLKDQLATRSNNAT
RQTRGITPLNSAFGGAEFKPHGIAARTAFKPYGSNQNAKNPAYDRTARKAGIDPGMFDGD
KDRFDKWITKIADKFVEDDETYKTERSRMAVINSLTEGLANDLIQGRYKSTIMPFSSAAE
MVATLAAVYHDDNQASKAREELRHLKFSLSDKSTDIHQFIGKVNSLADKANIAKTERKLV
LYEHIPANLNPQLLSLSKDPNISYETFAGEVANSALAQQRAWEELRENRKKREERRERSA
SAERKQRRRENRRHSQEAKNQTRTQTIDAPKSPSRENAKLVTEGRCFLCKEAGHLARNCP
QKAAHIAAVLALQHEGDREACERSGHSLSSSDSENC
Download sequence
Identical sequences 148305.A4QZF4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]