SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 148305.A4R1W1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  148305.A4R1W1
Domain Number 1 Region: 7-60
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000538
Family Psq domain 0.031
Further Details:      
 
Domain Number 2 Region: 505-540
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000127
Family Retrovirus zinc finger-like domains 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 148305.A4R1W1
Sequence length 556
Comment (Magnaporthe grisea)
Sequence
MESSNCEARIILALNELRSSKKKSIRKVALIYNVPKSTLHDRINGIASLANRRPGNQKLT
EREEEVIVQYILDLDSRGFPAQIADVAAMADHLLAARDARPVGKQWAYRFVQRRTELKTR
FSRAYDFQRALCEDPDALNAWFQLVANMRAKYGIQDCDMYNFDETGFMMGQICAGMVVTG
SERRGRRKKVQPGNREWATAICCISGDGYDIPPYIIVKGFYHLSNWYTEGGLPDTWRLKP
TVNGWTDNETGLDWVQHFDNHTKSRTKGVYRMLVLDGHGSHRSPEFEGYCKNHNIIPLYL
PAHSSHLTQPLDVGVFNVLKRAYGQKINDFIRAHITNISKVDFFLAFAAAYKKSMTKENM
AGGFRGAGIIPHSPEMVISKLDVRLRTPSPKELDFSSTETWVSQTPHNPTEAVNQSTLVK
SRINCHQGSSPTPIFNAVKQLAKGLESIAHRTTLLEAENHSLRKANEALSKRRRAQKTRI
REGGSFTIQEGQNLLQSNGADGLIYEKKDENGEGSSAQPATKRRCGNCGKPGHNARTCQE
DAEMSDVHISDCIEVN
Download sequence
Identical sequences 148305.A4R1W1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]