SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 148305.A4R1W3 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  148305.A4R1W3
Domain Number 1 Region: 740-988
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.15e-56
Family Reverse transcriptase 0.0016
Further Details:      
 
Domain Number 2 Region: 451-481
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000166
Family Retrovirus zinc finger-like domains 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 148305.A4R1W3
Sequence length 1133
Comment (Magnaporthe grisea)
Sequence
MFPNVISVRIRPLDLPSESRLGSTPSQGSDKNPLPPDLNASLERVVDCTAIPNTEGSDQN
GEITIAPVSPEPVKPAPTSANTEPEKPVEPQSDTEQDQPVDSIEVDGSYEYESVSEHPGE
ARNPPHQPSAKTLDGRNEIPKFPSRAPSPVLQDLLATIAQLKDQLATRSNNATRQTRGIT
PLNSAFGGAEFKPHGIAARTAFKLYGSNQNAKNPAYDRTARKAGIDPGMFNGDKDRFDKW
ITKIADKFVEDDETYKTERSRMAVINSLTEGLANDLIQGRYKSTIMPFSSAAEMVATLAA
VYHDDNQTSKTREELRHLKFSLSDKLTDIHQFIGKVNSLADKANIAKTERKLVLYKHIPA
NLNPQLLSLSKDPNISYETFAGEVANSALAQQRAWEELRENRKKREERRERSASAERKQR
RRENRRHSQEAKNQARTQTVDAPKSPSRENAKLVIEGKCFLCKEAGHLARNCPQKAAHIA
AVLALQHEGDREADIYLSIRPSLAKKVAQRLELPIKKLPKPLDFGDFNRKVTARATEYLR
LTLQIDGRQFPRQKFILLETAHDVFIGQEWWTKYRVGLFPATRSFVWPNDLPAMAQYSPA
IVVQRSNPPLDLEAQTDAVRRDRKMEQENRRIQVRKILQGPKRQHGNQAQIAEISAFPTI
PKTVSNKALPANICALLNDPRQNQWKRSPLPTEPIPLVPVNDTPTTSLNAVLALQWNKTH
DGRPIPFPADEDPEHIAQVGPAWFQAFINAQFNKLLDAFASAYADDVLIYTEDKSEQVHF
EQTEEVIYRLQKAGLQGDIKKSSFGVFEIEYLGLLLEIGKGIRIDPKKVEAITSWQWDNI
TSVSAVRSFLGLCNFVRTFCHHASEQAEPLTRLLKKGVPFERGPEQKSAFEALKQLVVTA
PVMSFFKPGMPVRMDTDASGRATAGVDQKLLAVINTLKDFEPALLGTKFCVFTNHQALIY
WSTKKLLSARQIRWANYLANFDIIFKYRPGKDNVAADALSRKTIDNPTVKARAVLDRTIA
LIPPEKIDSRPGEPFPTISNLEPSAPQGADLVALILEENLKQNLGHHDNLLTVPETTQDG
KIFLRTALIRETYKPKIFGHGGQNKTLSRLKKDYWWPDRNRDVKRYIKNCREC
Download sequence
Identical sequences 148305.A4R1W3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]