SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 148305.A4R1Y1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  148305.A4R1Y1
Domain Number 1 Region: 51-84
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000384
Family Retrovirus zinc finger-like domains 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 148305.A4R1Y1
Sequence length 246
Comment (Magnaporthe grisea)
Sequence
MTEETKILQFYQGLKSEVKDEVSKLDRPENFLEKNKADSELDPWTSVPHNTRSPRKDPKS
GKCFKCDKTGHIARNCPRNQEDIPDFRGKTEKPRGLNATNYQQLRPDQHSTMSWTTCYDN
NCMVHNSSKNDAGWYPQKPRGTRTLAVGNRVPLGTGQPTKLHRQETQLPELTDSDASGES
DEEPLGQTHHIRTTNQSSTQESSEDSEEESSEEETMPSSQYNAARENNPYITLGSTSPTP
LKSGPP
Download sequence
Identical sequences 148305.A4R1Y1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]