SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 148305.A4R258 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  148305.A4R258
Domain Number 1 Region: 194-315
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.34e-27
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000253
Further Details:      
 
Domain Number 2 Region: 309-361
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000000778
Family Retrovirus zinc finger-like domains 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 148305.A4R258
Sequence length 638
Comment (Magnaporthe grisea)
Sequence
MSWRNQGITGSNNIPLGKTRRFGGEAEPEDAQPSFNSGSNSAPSQPSYSGGFNGGDRDAK
RGRSPEPRSEADGPKRRKKRNRWGDATDNKAAGLMGLPTAVMANMTAEQLEAYTLHLRIE
EITQKLKIDDVVPADGDRSPSPAPQYDNQGRRVNTREYRYRKKLEDERHKLIEKAIKTIP
NYHPPSDYRRPTKTQEKVYVPVNDYPEINFIGLLIGPRGNTLKKMESESGAKIAIRGKGS
VKEGKGRSDAAHTSNQEEDLHCLIMADTEEKVNKAKKLIHNVIETAASIPEGQNELKRNQ
LRELAALNGTLRDDENQACQNCGQIGHRKWECPEKQNYTTNIICRVCGNAGHMARDCPDR
QRGASWRNDGPGFRSAGRIGAGPTSGAEVVDQEYEALMQEINGGPGGAAPARIEAGPGGP
PTGPSGGGDNARPWQRGPTGGAAPWRQRNNDRENNDDGPRGGGFGGGSGGPAPWARDRQN
RQHEDRDRGDGDQPWRNRDRGDRDHRDRDRERDRDRDRGYNSHGGDNGYSAASASAPAPW
SQPAGAPGYGAYPGYGSYGGPPGMGAPGMPAPPGLPGAPPGLPGAPGLNAPPGLPSDFNV
SALIAQYSGGAPPPPPPSGDAPPPPPGDQSPPPPPPGA
Download sequence
Identical sequences G4MLL7
XP_003709462.1.18062 MGG_06748T0 148305.A4R258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]