SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 148305.A4R2U8 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  148305.A4R2U8
Domain Number 1 Region: 342-378
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000012
Family Retrovirus zinc finger-like domains 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 148305.A4R2U8
Sequence length 406
Comment (Magnaporthe grisea)
Sequence
MSPRKNYGPPIRQSQRVTNANSAKPDNLASGTATPNTEDSDQNGEITVAPVSPEPVEPAP
TSANTEPEEPVEPQSDTEQDQPVDSIEVDGSYEYESVSEHPGEARNPPHQPSAKTTARKA
GIDPGMFDGDKDRFDKWITKIADKFVEDDETYKTERSRMAVINSLTEGLANDLIQGRYES
TIMPFSSAAEMVATLAAVYHDDNQASKAREELRHLKFSLSDKSTDIHQFIGKVNSLADKA
NIAKTERKLVLYEHIPANLNPQLLSLSKDPNISYETFAGEVANSALAQQRAWEELRENRK
KREERRERSASAERKQRRRENRRHSQEAKNQTRTQTIDAPKSPSRENAKLVTEGRCFLCK
EAGHLARNCPQKAAHIAAVLALQHEGDREACERSGHSLSSSDSENC
Download sequence
Identical sequences 148305.A4R2U8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]