SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 148305.A4R333 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  148305.A4R333
Domain Number 1 Region: 382-419
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000174
Family Retrovirus zinc finger-like domains 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 148305.A4R333
Sequence length 445
Comment (Magnaporthe grisea)
Sequence
MPRLKDHPPASRKSQRLITNQTEQTDRPIDDPTRSESETDSRPGTKSSVEDEIEVASSSR
SPELNVNAQENNPRMMGDANDPASEIARLEAEILRLRNALRNDTPSPRPYRELRHREPSV
ESAFGGTSFKAKGMAAWPAFTEFQGTGGINPVYNDKAKARADSPPKFAGDKTQFDSWLIK
VADKFEEDVAIFRTEKSRMRYLMNLLEDKAEKAMITRYVSVTRPFSSVAEMIQILESMYH
DPNQSIAAREALKKHEFELGKGQDIHEFIATFNSLAQQAKVREEDWKQTLWGCIPADLDH
RLLHDSENIDIDYETFCQYVTKAVYSNQLAQERRKDRESTDKTSTKNETRSRQKTASTKV
RSRYKPKDYQGDRTEPITMAKAGRSLTYEEKKAHWDANTCFMCGRGGHNSKDCPEKERIR
DVKAVKQKQQTSTLDSETTDESGKE
Download sequence
Identical sequences 148305.A4R333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]