SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 148305.A4R440 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  148305.A4R440
Domain Number 1 Region: 617-648
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000171
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 148305.A4R440
Sequence length 676
Comment (Magnaporthe grisea)
Sequence
MHTHPFTYVGPNYVEAFPLHIAERVFRHINRRVASKSIPSAGQGAAAAASSSISAAQTIS
SCTRSCSTCRKLRMSAPAASHGRALLFEMLDRELEVCECCDEVLRTGIAGAGSRRAVSAR
SLIIVRIRPPDLPSESRLGSTSHAEPGIGQGPQKTPFAKSMSPRKNYGPPIRQSQRVTNA
NSAKPDNLASGTATPNTEDSDQNGEITVAPVSPEPVEPAPTSANTEPEEPVEPQSDTEQD
QPVDSIEVDGSYEYESVSEHPGEARNPPHQPSAKTLDGRNEIPKFPSRAPSPVVQMRSEM
ADESENTAGQATITQSQLQDLLATIAQLKDQLATRSNNATRQTRGITPLNSAFGGAEFKP
HGIAARAAFKPYGSNQNAKNPAYDRTARKAGIDPGMFNGDKDRFDKWITKIADKFVEDDE
TYKTERSPMAVINSLTEGLANDLIQGRYESTIIPFSSAAEMVATLAAVYHDDNQASKARE
ELRHLKFSLSDKSTDIHQFIGKVNSLADKANIAKTERKLVLYEHVPASLNPQLLSLSKDP
NISYETFAGEVANSALAQQRAWEELRENRKKREERRERSASAERKQRRRENRRHSQEAKN
QARTQTVDAPKSPSRENAKLVIEGKCFLCQEAGHLARNCPQKAAHIAAVLALQHEGDREA
GERSGHSSTSSDSENC
Download sequence
Identical sequences 148305.A4R440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]