SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 148305.A4R5Z8 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  148305.A4R5Z8
Domain Number 1 Region: 257-291
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000488
Family Retrovirus zinc finger-like domains 0.0034
Further Details:      
 
Weak hits

Sequence:  148305.A4R5Z8
Domain Number - Region: 26-167
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.051
Family Apolipoprotein A-I 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 148305.A4R5Z8
Sequence length 355
Comment (Magnaporthe grisea)
Sequence
MSSQSSKNNTPSTPATSSKAAQKAPARPKDDSDSEDEEDQLRRQVARTNQELHEQTLRAT
QLQEELQALRASANVTSTPLDGRERLKLNPPATFDGTPGQLKGYLVQVRTYQAFHLETFR
SETEKVVHAATFLRGRALSWFEPLLQEWLDVPPEERRQEVTDIFSTFAGYERTLRSLFQE
PDEKRQTERDLANLRQTKSASAYAAEFRRLATRLDMTEETKILQFYQGLKSEIKDEVSKL
DRPEDFLDGPMDLSATQHKKPRKDPKNGKCFKCDKTGHIARNCPRNQEDIPDFRGKTEKP
RGLNATNYQQLRPNQHSTMSWTTCYDDNCMTHNSSKIDAGWYPQKPRGTRTLAEN
Download sequence
Identical sequences G4NG82
148305.A4R5Z8 XP_003719406.1.18062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]