SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 148305.A4R6A1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  148305.A4R6A1
Domain Number 1 Region: 322-358
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000123
Family Retrovirus zinc finger-like domains 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 148305.A4R6A1
Sequence length 407
Comment (Magnaporthe grisea)
Sequence
MQEAETQRARAETQGARAETDRVRDKAQADILAMAMEKASAITSRDAAFAELEKTRSELK
EVRTVTLPTVHITTPAPTTNTPVEPLMVTPMGTTPPPASEHPASARLSERLPDPDKFTGA
RSDLRRFATQIRGKMTSNKDRFPNPESRLIYVAGRLSGKAYNLILPKMVGGTPQFGDYTD
LLQYLEEAFGDPDHVQNAQNKLYALKQRNVDFAEYLSEFQRLSLEGEMPEDALPPLLFQG
ISEELQDMLLHNPAPSRQYHEFTRHLQSLDNRYRQHQQYKNRQTRTPRTAAPPARAAPRT
QTDIPRAAPKPNAEFPFNDPMDLSSQRRHNRKENMLCYRCGSQEHFVAKCPEPDTRRTRL
HQAGIEQSRSRSRSPRQMQTKLPENPRRGSDASRSSSRSSKNGARLG
Download sequence
Identical sequences 148305.A4R6A1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]