SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 148305.A4RGA9 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  148305.A4RGA9
Domain Number 1 Region: 249-287
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000106
Family Retrovirus zinc finger-like domains 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 148305.A4RGA9
Sequence length 312
Comment (Magnaporthe grisea)
Sequence
MAAWPAFTEFQGTGGINPVYNDKAKARADSPPKFAGDKTQFDSWLIKVADKFEEDVAIFR
TEKSRMRYLMNLLEDKAEKAMITRYVSVTRPFSSVAEMIQILESMYHDPNQSIAAREALK
KHEFELGKGQDIHEFIATFNSLAQQAKVREEDWKQTLWGCIPADLDHRLLHDSENIDIDY
ETFCQYVTKAVYSNQLAQERRKDRESTDKTSTKNETRSRQKTASTKVRSRYKPKDYQGDR
TEPITMAKAGRSLTYEEKKAHWDANTCFMCGRGGHNSKDCPEKERIRDVKAVKQKQQTST
LDSETTDESGKE
Download sequence
Identical sequences 148305.A4RGA9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]