SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 148305.A4RGC7 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  148305.A4RGC7
Domain Number 1 Region: 245-279
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000593
Family Retrovirus zinc finger-like domains 0.0033
Further Details:      
 
Weak hits

Sequence:  148305.A4RGC7
Domain Number - Region: 47-139
Classification Level Classification E-value
Superfamily Heme oxygenase-like 0.0233
Family TENA/THI-4 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 148305.A4RGC7
Sequence length 390
Comment (Magnaporthe grisea)
Sequence
MSSQTFKNNTPSTPATSSKAAQKAPVRPKDDSDSEDEEDQFRRQVAQTNQELHEQTLRAT
QLQEELQALRASANVRTYQAFHLETFRSETEKVVHAATFLRGRALSWFEPLLQEWLDVPP
EERRQEVTDIFSTFAGYERTLRSLFQEPDEKRQTERDLANLRQTKSASAYAAEFRRLTTR
LDMTEETKILQFYQGLKSEVKDEVSKLDRPEDFLDGWQQPRHTAPQTYSTAYNTHSGPMD
LSATQHKKPRKDPKSGKCFKCDKTGHIARNCPRNQEDIPDFRGKTEKPRGINATNHQQLR
PDQHSTMSWTTCYDDNCMVHNSSKNDAGWYPQKPRGTRTLAVENRVPLGTGQPTKLHRQE
TQLPELTDSDASGESDEELLGQTHHIRTTN
Download sequence
Identical sequences 148305.A4RGC7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]