SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 148305.A4RGL9 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  148305.A4RGL9
Domain Number 1 Region: 875-1307
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 4.56e-165
Family Reverse transcriptase 0.0000226
Further Details:      
 
Domain Number 2 Region: 1423-1562
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.2e-31
Family Retroviral integrase, catalytic domain 0.022
Further Details:      
 
Domain Number 3 Region: 683-793
Classification Level Classification E-value
Superfamily Acid proteases 0.0000000006
Family Retroviral protease (retropepsin) 0.022
Further Details:      
 
Domain Number 4 Region: 329-363
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000733
Family Retrovirus zinc finger-like domains 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 148305.A4RGL9
Sequence length 1591
Comment (Magnaporthe grisea)
Sequence
MSSQTSKNNTPSTPATSSKAAQKAPARPKDDSDSEDEEDQLRRQVARTNQELHEQTLRAT
QLQEELQALRASANVTSTPLDGRERLKLNPPATFDGTPGQLKGYLVQVRTYQAFHLETFR
SETEKVVHAATFLRGRALSWFEPLLQEWLDVPPEERRQEVTDIFSTFAGYKRTLRSLFQE
PDEKRQTERDLANLRQTKSASAYAAEFRRLATRLDMTEETKILQFYQGLKSEVKDEVSKL
DRPEDFLEYVELAIKLDNRIYERRQEKQGGQRVFVTSTRQANTGRKYQHPQPTHHRNNGG
WQQPRHMAPQTYSTAYGTHSGPMDLSATQHKKPRKDPKSGKCFKCDKTGHIAKNCPRNQE
DIPDFRGKTEKPRGLNATNHQQLRPDQHSTMSWTTCYDDNCMVHNSSKNDAGWYPQKPRG
TRTLAVGNRVPLGTGQPTKLHRQETQLPELTDSDASGESDEEPLGQTHHIRTTNQSSTQE
SSEDSEEESSEEETIPSSQYNAARENNPYIYEKKHIDLYRDDQSVQFPGLPLQAQIRHPT
GPVSATFGDHPTLDTKHPQHAEIFWAECFRDNCGLHLSRKIVHNFFPRRRKATGIHEVYT
TTDLPNWEIKIRLNTEPAAIFTPNDNYPMACCNQKQFPWYECTRSVCRVHMLAKAQAWHE
QKSRQPGPAPMTRIVWNPNDTIAAHEHIFLDIRLDGRPIRALLDSGAQGNYISPRVVAKR
RIPWQQKKEPYQLQTVEGEAVSYGNGTIETETVHLWMESYGRKEQITLDITEIGDKDVIL
GIPWLRRSNPRINWTTGQVQWEEPLASEGKSEKRTSRNERRAQERNQQKIMALLRKSEPR
LEPTSEGSRLSMSEERSNLTTLIDNIPAEYRMYGRLFSPELETGLPEHSPFDHEIPLKEG
TQPKFHKIYGLNPTQMEALDKYLAENLKKGYIRPSTSPAGYPILFVPKKNGKLRLCVDYR
QLNDITIKNCYPLPLIGELRDMLYQAQWFTTLDLKGAYNLIRMKEGEEWKTAFRTRRGHY
EYLVMPFGLTNAPATFQTMINHVLRECLDIFVVVYLDDILVFSKTLEEHKQHVHTVLQKL
QDAKLLVEPEKCLFHSKQVNFLGYTIAPGEIRMEKSKIQAVKEWPQPQNVRDVRAFLGFV
NFYRRFIKGYGAITTPLTNMTKKDLEFQWTEQTQQAFEQLRDAVAREPILKIPDPTKPFE
VETDASDYAIGGQLSQRDEEGRLHPCAFFSQKLHGPELNYQIHDKELMAIIRAFEEWKPQ
LSGTKHEVLVYTDHKNLTHFTTSKMLNKRQIRWSEFLSEFHFRIIYRKGTENGRADALSR
RPDHENTVPEETRVILTTDGNRNLLPAHRSLMTTNTVTTPEEIRKIHGNKAHGHQGISKT
WKRLKQHHNFKGTRQEVREAIKDCELCAKSKSARHRPYGLLQPLPAPSKAWQTITMDFIV
KLPPSEEPLTKTKYDSILVIVDKLTKYAYFLPYKESSNAEEIAYTFLRVIVSNYGLPENI
ITDRDKLFTSRFWKSLMEQLGTDHKLSTAFHPQTDGQTERANQTLEQYLRCYVNHKQDNW
RTENQEPRLRHREPINKRASYDNYTKNSSRN
Download sequence
Identical sequences 148305.A4RGL9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]