SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 148305.A4RIL3 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  148305.A4RIL3
Domain Number 1 Region: 281-315
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000506
Family Retrovirus zinc finger-like domains 0.0033
Further Details:      
 
Weak hits

Sequence:  148305.A4RIL3
Domain Number - Region: 25-167
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0301
Family Apolipoprotein A-I 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 148305.A4RIL3
Sequence length 357
Comment (Magnaporthe grisea)
Sequence
MSSQTSKNNTPSTPATSSKAAQKAPVRPKDDSDSEDEEDQLRRQVAQTNQELHEQTLRAT
QLQEELQALRASANVTSTPLDGRERLKLNPPATFDGTPGQLKGYLVQVRTYQAFHLETFR
SETEKVVHAATFLRGRALSWFEPLLQEWLDVPPEERRQEVTDIFSTFAGYERTLRSLFQE
PDEKRQTERDLANLRQTKSASAYAAEFRRLATRLDMTEETKILQFYQGLKSEVKDEVSKL
DRPEDFLENNGGWQQPRHMAPQTYSTAYGTHSGPMDLSATQHKKPRKDPKSGKCFKCDKT
GHIARNCPRNQEDIPDFRGKTEKPRGLNATNHRQLRPDQHSTISWTTCYNNNSYICN
Download sequence
Identical sequences 148305.A4RIL3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]