SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 148305.A4RJX6 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  148305.A4RJX6
Domain Number 1 Region: 8-36
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000558
Family Retrovirus zinc finger-like domains 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 148305.A4RJX6
Sequence length 709
Comment (Magnaporthe grisea)
Sequence
MAARAPGQDAAREEPSCFNCGIKGHFAIACPEEVRKEPAGLQAFRERKAAAQSKGSRGGP
GQGKGSGGTGMIITKYAPPPHPSLPQPPPAAAILGYYPQPTPPPHAAHPAQSAGPPAWHY
PPSNYSPAYQAPPPPPPPTPAHHAQPPYEPYAHPAYPPAAPNGGSYYPPPYSAPPPPPQP
PYYPGPQSTYNSPIYPPPAQSAPVPGFPYPPATPPISASPSYPYTAPPPPTYTPHPFDAA
QGYYPPSYLDERGRGNFCPGARGHGQSRPRGGSNNRDRDRHRDRDRDRERHRGRDRDRNF
GSKNQRKGVLQKAQTLPQTSGKASPPSEPQKDKLEGSPITPAKATGKPKTPERGQSPGIE
DILGCDLESAFTELPTKPADPVGQPLPSEYTDAPTIPPAFDAKCLKSEFFSADDCDSFSS
SIRDTKYWKNAKHDPVFKAWAGMVSRRFVNSIHLYHSYRTSSAPSPDEIIAEDVVLDEIV
VQPSPPRVSSPTVSNPRLPGAKSDVLGKHARGPADGGEKQSSLKRFKGIAGLPKLSAFQS
PPGVKRHHQRGEGGSHLSQDSRDDRNTHRDSPRSRESPYNSRARHDSGYQSNNSPDKPYG
ERFYGSSNATRDHRGQSRSRPQSRSRSRSRSSSRQRGREAYKQQSLSKSPSGRHGRHGSP
SYARTRSSSPLDDFEREILGIAREEAPEKKAAKPKRRHDRLVEVFSRRW
Download sequence
Identical sequences G4MUU4 L7IJW3 L7JG66
148305.A4RJX6 XP_003714681.1.18062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]