SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 148305.A4RLF2 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  148305.A4RLF2
Domain Number - Region: 1106-1129
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00611
Family Retrovirus zinc finger-like domains 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 148305.A4RLF2
Sequence length 1184
Comment (Magnaporthe grisea)
Sequence
MTEKDAAKPDPEASAAPGATPPASDDDWERQKLADNETMRKLLDQDSNGQVNILPQEYMN
EDYTFDQSGKADDAEDFEDISDDDLPEEEETAGTQTASAELPGLTDDGGTSNDNDDLWGE
GEGDGDADLGPSSPLIGAPSSPPPEAADDTDADTMDTSPDAKEREDSAPYKPSDFDINFP
TADYSLNQDPSIPAVAQTELELVKSVWPTFDTGTQFDWNRLLPPKKATWVGKKPTRAPKP
LAPTKLSLDLEVDQEKTFRVPGPAAGTTRQKIRDAEAKGLVSCLVPEPIEEADITIFSRE
LDDDNETVGGFTLADIETICFDFESMIDAGQPISPPLTPTLNAHGDDEDDWDKMFLDSQP
AAKRRKIEVERGLPRIPRFVAPSFDQFEEATARAAKRVHLDFADPHLLIEEQTVKHRKLN
NTKAANGRLGRNALSRFNFANDEQYENLKLNHKHKVRATIGNMAVEHSIPAIKLLWPYYS
VKPEAIQPYDYHRPLLQTNKGAGDWVRFSQPTKRKRKIEKNRKVQETFSSSKDLTLNDNS
YVVLFEYSEQIPTVLSKFGMGNKIVNHARKRINTEDESSVVDKKVYELGEENILTTEDKS
PFSTFGRVEQGEVVPTLTNAMYHAPIFKHQPRKTDFILGRSTTGKEGPFYYLRKIDHLYV
VGQNFPSMEVPGPHSRKVTTLSKNRMKMIAYRLIHSKGAVELPEMTKHVKGSTDPQNRQK
LKEFLSYDKNIKAWKIKESDTLLDKDSIDKMIKPEDVCLNDAHQVGAGELLINGYTVSKV
EENDHDLDDGNEQSFAKSMSPWNTTKAFIDACAGKAMVRLRGPGDPTGHGLGFSFIKTSM
KGGYMEALQKDRGPGNTANDAMTIEAQRKDANGHSYNVKQQEELYNKEIGEIWTKQKMTL
SDPMEHDDEDMQKMDDEDDRFYGNGNASANASFAQSGNFGGSQAPASSIMPPTPGGIGGS
TVIDDKTSVFSRRSATEIGGASGVGGGRKKMLKIYRRMADGSEETVEMVFDEKVMKRYID
QRREARSNEIDVFSENIGFTNDEEYNAAMIQRINQEQARLIRNKERRLQREKSKSKLGPS
VAAARASTPSGGPNDPDSPAPSIEKGAGAPAGGTSRKCANCGQVGHIKTNKKYRRPSHDD
PAPPRHNPDTPPTFIYYTCRRCVLKLLNRRKGNKVSASAVACAH
Download sequence
Identical sequences L7IJC4 L7J0V2
148305.A4RLF2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]