SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 148305.A4RPB5 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  148305.A4RPB5
Domain Number 1 Region: 610-996
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.78e-150
Family Reverse transcriptase 0.0000222
Further Details:      
 
Domain Number 2 Region: 209-244
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000192
Family Retrovirus zinc finger-like domains 0.0033
Further Details:      
 
Domain Number 3 Region: 432-528
Classification Level Classification E-value
Superfamily Acid proteases 0.00000108
Family Retroviral protease (retropepsin) 0.042
Further Details:      
 
Weak hits

Sequence:  148305.A4RPB5
Domain Number - Region: 274-295
Classification Level Classification E-value
Superfamily Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain 0.0301
Family Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 148305.A4RPB5
Sequence length 999
Comment (Magnaporthe grisea)
Sequence
MSSQTSKNNTPSTPATSSKAAQKAPVRPKDDSDSEDEEDQLRRQVARTNQELHEQTLRAT
QLQEELQALRASANVTSTPLDGRERLKLNPPATFDGTPGQLKGYLVQEPDEKRQTERDLA
NLRQTKSASAYAAEFRRLATRLDMTEETKILQFYQGLKSEVKDEVSKLDRPEDFLENNGG
WQQPRHMAPQTYSTAYGTHSGPMDLSATQHKKPRKDPKSGKCFKCDKTGHIARNCPRNQE
DIPNFRGKTEKPRGLNATNHRQLRPDQHSTISWTTCYNNNCITHNSSKIDAGWYPQKPRG
TRTLAVGNRVPLGTGQSTKLHRQETQLPELTDSDASGESDEEPLGQTHHIRTTNQSSTQE
SSEDSEEESSEEETMPSSQYNAARENNPYIYEKKHIDLHRDDQLPQFSHLTTTTPWRVAT
RNSSHGTNAPEAPIRALLDSGAQGNYISPRVVAKRRIPWQQKKEPYQLQTVEGEAVSYGN
GTIETETVHLWMESYGRKEQITLDITEIGDKDVILGIPWLRRSNPRIDWTTGQVQWEEPL
ASEGKSEKRTSRNERRAQERNQQNIMALLRKSEPRLEPTSEGSRLSMSEERSNLTTLIDN
IPAEYRMYGRLFSPELETGLPEHSPFDHEIPLKEGTQPKFHKIYGLNPTQMEALDEYLAE
NLKKGYIRPLTLPAGYPILFVPKKNGKLRLCVDYRQLNDITIKNCYPLPLIGELRDMLYQ
AQWFTTLDLKGAYNLIRVKEGEEWKTAFRTRRGHYKYLVMPFGLTNAPATFQTMINHVLR
ECLDIFVVVYLDDILVFSKTLEEHRQHVHTVLQKLQDAKLLVEPEKCLFHSKQVNFLGYT
IAPGEIRMEESKIQAVKEWPQPQNVKDVRAFLGFVNFYRRFIKGYGAIATPLTNMTKKDL
EFQWTEQTQQAFEQLRDAVAREPILKIPDPTKPFEVETDASDYAIGGQLSQRDEEGRLHP
CAFFSQKLHGPELNYQIHDKELMAIIRAFEEWKPQLSRN
Download sequence
Identical sequences 148305.A4RPB5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]