SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 148305.A4RPD3 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  148305.A4RPD3
Domain Number 1 Region: 698-1082
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.67e-93
Family Reverse transcriptase 0.00051
Further Details:      
 
Domain Number 2 Region: 1472-1537
Classification Level Classification E-value
Superfamily Chromo domain-like 0.000000000000014
Family Chromo domain 0.0052
Further Details:      
 
Domain Number 3 Region: 1271-1337
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000129
Family Retroviral integrase, catalytic domain 0.016
Further Details:      
 
Domain Number 4 Region: 382-419
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000658
Family Retrovirus zinc finger-like domains 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 148305.A4RPD3
Sequence length 1577
Comment (Magnaporthe grisea)
Sequence
MPRLKDHPPASRKSQRLITNQTEQTDRPIDDPTRSESETDFRPGTKSSVEDEIEVASSSR
SPELNVNAQENNPRMISDANDPASEIARLEAEILRLRNALRNDTPSPRPYRELRHREPSV
ESAFGGTSFKAKGMAAWPAFTEFQGTGGINPAYNDKAKARADSPPKFAGDKTQFDSWLIK
VADKFEEDVAIFRTEKSRMRYLMNLLEDKAEKAMITRYVSVTRPFSSAAEMIQILESMYH
DPNQSIAAREALKKHEFELGKGQDIHEFIATFNSLAQQTKVREEDWKQTLWGCIPADLDH
RLLHDSENIDIDYETFCQYVTKAVYSNQLAQERRKDRESTDKTSTKNETRSRQKTVSTKV
RSRYKPKDYQGDRTEPITMAKAGRSLTYEEKKAHWDANTCFICGRGGHNSKDCPEKERIR
DVKAVKPKQQTSSLDSETTDESGKDPAIAEQAAERLGARLQRLKTPLLLSDYRKQDAGRI
THKLKATLEIDGRRFSNQMFYVTESGHNMFIGQDWLVEQDVWIHPKTQTFAWPERTPSLA
KFSPAIRLPNMLDKPDPVAQTDAERRDRAFERETKRVQILRRPWRQTTFLKPRPTTPVVL
GEDRDVVNIAALQHKLDTDPRQKRWKSCPIPTQPITLEIGPEKPAISLSAVGRSYQWKTN
KGEPIPFPEDEDPDHVELVRSKLPSRLAHLEGFFSKAASTNLPPHRPGHDVILELDKPKT
GSPPTYRTPVEFLPLEKETVDELLRIGFIEPCMQADPAPVLFVPKPHSKERRFCTDYRWI
NQFLKDRFVPAPDVNGTIFNCRNAKRFTKIDIIRAFNRLRMAVGSDAYADDVLVYSDGNE
EEHWDQVEEVIYRLSRVDLQGDIKKSRFNVTTVDYLGIVMDAGLGIRIDPDKLQAISDWK
FEDLTSKTAVRSFLGLCNYIRMFCHHASSVAEPLNRLLKKDAKFAMGPEQRRAFEEMKRL
ACDAPVMAFFTPGRPTKVETDASRNATGGAIWQQQPGGEWKPVGYFSKTMTPAERAYPIQ
DRELLAVVQTLKHYEPELLGTSFFVVTDHQALVYYSTKRLLSTRQVRWADFLANFNITFQ
YRRGKDNIAADALSRKTADLPTVKAREKEERTMILIPPEKITPTVAAVSTADPNAHVVSG
ADLVDLIRQENEKQKLGQHQGKLVVPETTLDGQIFLRTALIREAHEPKIFAHAGQNKTIQ
MIKRRYFWEGMSQTIRKYIKNCHDCERNKGRHDKTPGLLHPLPIPNYVWEHVAVDGKDMP
KDKFGYDYVALHPQTQGAVEITNQELDQKLRFYIDKYQTSWSVHLPALDFAHNAAWHSSL
GMCPLKVVLGTEPRNPLSTDLPTTTVNSDQKRKALQIVRQTKEVQELARQNALKTQARQE
EQANKKRRPVDFGVNDYVFVKKKGFPTTAPTTRLDSQWTGPWQILEERGYSYVLDVPESF
KGKNLFHADRLRKAAMDPLPQQKREPPPPEEINGEPEFVVDKVLASRLFGRSKILQYQVA
WQGCDPDDTWYPAENFKNSATALDDFHKKYKDAAGPPKRLAIWIKAAAEDKLDEPNQEDN
VAEHGELNGKRKKRRHG
Download sequence
Identical sequences 148305.A4RPD3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]