SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 148305.A4RPP5 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  148305.A4RPP5
Domain Number 1 Region: 652-1090
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 5.56e-157
Family Reverse transcriptase 0.0000492
Further Details:      
 
Domain Number 2 Region: 370-405
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000445
Family Retrovirus zinc finger-like domains 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 148305.A4RPP5
Sequence length 1109
Comment (Magnaporthe grisea)
Sequence
MPASLQPPILTDSTEELIEHLQGHPEQWVSYISDSYQKLQLLHDSNVRLNSCLEMQEAET
QRARAETDRVRDKAQADILAMAMEKASAITSRDAAFAELEKTRSELKEVRTVTLPTVHIT
TPAPTTNTPVEPLMVTPMGTTPPPASEHPASARLSERLPDPDKFTGARSDLRRFATQIRG
KMTSNKDRFPNPESRLIYVAGRLSGKAYNLILPKMVGGTPQFGDYTDLLQYLEEAFGDPD
HVQNAQNKLYALKQRNVDFAEYLSEFQRLSLEGEMPEDALPPLLFQGISEELQDMLLHNP
APSRQYHEFTRHLQSLDNRYRQHQQYKNRQTRTPRAAAPPARAAPRTQPDIPRAAPKPNA
ELPLNDPMDLSSQRRHNRKENMLCYRCGSQEHFVAKCPEPDTRRTRLHQAGIERSRSRPP
AIRISAAAVHGFPVEEEYNQRSDLMILPAELTVGGQNLPTYALTDCGAEGKCFLDQGWAE
ERQLQMYPLRNPFDIEVFDGRTAESGKCTHYVRGQLRIKDHIQKNALFFVTQLAHYPIVL
GMPWLKQHDPTIGFASHVITFNSDYCRRHCNMPDKPEKVKALHAVPKKSRPQYQADRPPS
LREMDIAPISLQAASIYARRRSCRLYAVTLKQIDEVLAADPQNRNGPTLPETIREFADVF
SPQEAEKLPPHRPSDHHIPLIEGKTPPFGPLYAMSREELIALKEWLTAELKKGFIRPSSS
SVASPVLFVKKQGGGLRFCVDYRALNNITVKDRYPLPLVRETLNNLAGMKFFSKIDIVSA
FNNIRIKKGEEYLTAFRTKFGLYESLVMPFGLTGAPATFQRYINDSLREYLDVFCTAYLD
DILIYSRTRTEHEEHLKLVLEALRKAGLYANAAKGEFFVTETKFLGLLVGVEGVKMDPEK
ITAVLDWQTPKKLTDVQAFLGFGNFYRRFIRDFSKIVAPLTRLTEKDVAFEWNSACETAF
RLLKRKFTEAPVLAHFDWEKDVILETDASDYVSAGILSQYGDDGILRPVAFFSKKHTATE
CNYEIYDKELLAIIRCFEEWRPELEGTSSPVQVITDHRNLEYFTTTKMLNRRQARWAEFL
SRFNFRITYRPGKQGATPDAFNQEVRGYA
Download sequence
Identical sequences 148305.A4RPP5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]