SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 148305.A4RQ76 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  148305.A4RQ76
Domain Number 1 Region: 23-108
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.37e-25
Family Ubiquitin-related 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 148305.A4RQ76
Sequence length 109
Comment (Magnaporthe grisea)
Sequence
MSDRENGGSPHGDYPGAGGGAPAGGGDPAAPEHLNIKVTDNNNEVFFKIKRSTKLEKLMN
AFCDRQGKSLSQVRFLFDGQRVQPTDTPDTLEMADGDTLEVHQEQVGGA
Download sequence
Identical sequences G4MPJ3 L7I5T3 L7IVJ8
XP_003710648.1.18062 148305.A4RQ76 MGG_05737T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]