SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 148305.Q51LA6 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  148305.Q51LA6
Domain Number - Region: 73-94
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0222
Family Retrovirus zinc finger-like domains 0.006
Further Details:      
 
Domain Number - Region: 2-8
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0628
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 148305.Q51LA6
Sequence length 474
Comment (Magnaporthe grisea)
Sequence
MPPPPPPPRRPALGAAGASKEENVYIPNFISKRPFYAVDEGENTDYLEHQRIQKKEKDTG
WYDRGKTLGPAATKYRKGACENCGAMTHKVKDCLSRPRAKGAKWTGRDIKADELVQDVRM
GWDAKRDRWNGYDAREYQAVVEDYNKMEELRKEMQAKAAAESGKAIEDGDHYAETSDMSK
HQPTSTRQLRLREDTAKYLLNLDLDSAKYDPKTRTIVDAGATNDKTAELYAEQGFLRQSG
DAAEFEKAQRYAWEAQEKGGDTSLHLQANPTAGSYMRKKLKEEEDAKREERERQLREKYG
GEETKVLPDAIRQMAVTESERYVEYDEIGLIKGGPKGVARSKYKEDIFHNNHTSVWGSWW
SDFKWGYACCHSFVKNSYCTGEEGKAAWEAAERQRTGSGLLEPAADAEVDGAREEERKAS
EAETAAAAKEKAKKRTAEQMIGDVTEAELDEYRRKRTNTDDPMAQLLGRDELVT
Download sequence
Identical sequences L7I421 L7J0N5 Q51LA6
MGG_02985T0 148305.Q51LA6 XP_003720714.1.18062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]